PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g009190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family EIL
Protein Properties Length: 675aa    MW: 76022.5 Da    PI: 6.3262
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g009190.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3415.94.4e-127384011350
                       XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLra 93 
                       eel++rmwkd+++lkrlker+k    +++ a++++k++++++qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+g+sd++ra
  Sopen01g009190.1  38 EELERRMWKDRVKLKRLKERQKIA--AQQ-AAEKQKNKQTTDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGSSDNIRA 127
                       8*******************9964..455.599************************************************************ PP

                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT- CS
              EIN3  94 WWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelgl 186
                       WWkekv+fd+ngpaai+ky+a++   +++ s+  ++ + ++ l++lqD+tlgSLLs+lmqhcdppqr++plekgv+pPWWP+G+++ww ++gl
  Sopen01g009190.1 128 WWKEKVKFDKNGPAAIAKYEAECHSKGEGISN--QNGNPQSVLQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGVSPPWWPSGNDEWWVKMGL 218
                       *******************9988766655555..67999999*************************************************** PP

                       -TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX.....XXXX..X CS
              EIN3 187 skdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss.....slrk..q 270
                       +k q+ ppykkphdlkk++kv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes ++l+vl++ee+ ++    +  ss      +r   +
  Sopen01g009190.1 219 PKGQK-PPYKKPHDLKKMFKVGVLTAVIKHMSPDIAKIRRLVRQSKCLQDKMTAKESSIWLAVLSREESTIRLQTNDngSSsiseaPIRGhgD 310
                       *****.9**************************************************************997666666633566664444345 PP

                       XXXXXXXXXXXXXXX.......XXXXXX.XXXXXXXXXX.................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XX CS
              EIN3 271 spkvtlsceqkedve.......gkkeskikhvqavktta.................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgset 339
                       ++k  +++++++dv+                   +++++                 +++   +r+++++ ++  +    +++  s+q ++   
  Sopen01g009190.1 311 KKKSSVDSDSDYDVDdvnvsvsS----------RDERRNepldarpltdvpqshqsKEQGDGQRRRRKRARSNFQ---QTQLSPSEQQPDDVA 390
                       66666666777777744333321..........222222355667777666665443333333333333333332...246778888888888 PP

                       XXXXXXXXXXX CS
              EIN3 340 elifadknsis 350
                       ++ ++d+n+ +
  Sopen01g009190.1 391 RNSLPDMNNSN 401
                       88888887665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.4E-12438285No hitNo description
Gene3DG3DSA:1.10.3180.107.2E-69160290IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167688.63E-60166288IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 675 aa     Download sequence    Send to blast
MAVMDEIGID ISSDIEVDDI RCDNIAEKDV SDEEIDPEEL ERRMWKDRVK LKRLKERQKI  60
AAQQAAEKQK NKQTTDQARR KKMSRAQDGI LKYMLKLMEV CKARGFVYGI IPEKGKPVSG  120
SSDNIRAWWK EKVKFDKNGP AAIAKYEAEC HSKGEGISNQ NGNPQSVLQD LQDATLGSLL  180
SSLMQHCDPP QRKYPLEKGV SPPWWPSGND EWWVKMGLPK GQKPPYKKPH DLKKMFKVGV  240
LTAVIKHMSP DIAKIRRLVR QSKCLQDKMT AKESSIWLAV LSREESTIRL QTNDNGSSSI  300
SEAPIRGHGD KKKSSVDSDS DYDVDDVNVS VSSRDERRNE PLDARPLTDV PQSHQSKEQG  360
DGQRRRRKRA RSNFQQTQLS PSEQQPDDVA RNSLPDMNNS NAQFSGYIAN ESQPENNMMV  420
PRKSVERNSE GQSDLPLEES NLSMVPSANA VSTEETFVGN GPSIYPMLEN SEVVPYESRF  480
HPGTQDSVVQ RQLHDTQLQS RPQFSGMNNE PPNSIFHYGP PNNGLHNGSQ SSVLHHELQY  540
SGFIHGSQYS NLHKPPVYQY FTPSAEFGSA HEEQQSHLAF GQPQIKPQDS GVRSAVLHGD  600
RNGMSREDHH YGKDAFQNDH DRPAEMHFAS PITSGSPDYA RLSSPFNFEL DVPSPLDTGD  660
LELFLDEDVM TFFAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A3e-711652899133ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00649PBMTransfer from LOC_Os09g31400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015071748.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X2
SwissprotO231161e-176EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLK4AU850.0K4AU85_SOLLC; Uncharacterized protein
STRINGSolyc01g014480.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-156ETHYLENE-INSENSITIVE3-like 3